132720-HRP

ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (HRP)

Size

£914.00

SKU:: 132720-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa401-511, from human ROCK1 (NP_005397) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: ROCK-1 (Rho-associated coiled coil-containing protein kinase 1) has been found to be a new caspase-3 substrate. ROCK-1 consists of an amino-terminal kinase domain and an inhibitory cysteine/histidine-rich C-terminal domain. During apoptosis, ROCK-1 is cleaved by caspase-3 at the conserved DETD1113/G sequence and its C-terminal inhibitory domain is removed, resulting in deregulated and constitutive kinase activity. The caspase-3 mediated cleavage and activation of ROCK-1 induces phosphorylation of MLC and membrane blebbing, the early events in the execution phase of apoptosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice