ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1)

Size

£685.00

SKU:: 132715
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa491-590, from human ROBO1 (NP_002932) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Roundabout Homolog 1 (ROBO1) is a type I transmembrane protein belonging to the ROBO family, which defines a novel subfamily of immunoglobulin superfamily proteins. ROBO family proteins are evolutionarily conserved receptors that interact with the secreted Slit proteins. ROBO-Slit interactions play an important role in axon guidance across the midline during central nervous system development. ROBO signaling also has a role in tumor angiogenesis and immune responses. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.