132715-BIOTIN
ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (Biotin)
Size
£914.00
- SKU:
- 132715-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa491-590, from human ROBO1 (NP_002932) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Roundabout Homolog 1 (ROBO1) is a type I transmembrane protein belonging to the ROBO family, which defines a novel subfamily of immunoglobulin superfamily proteins. ROBO family proteins are evolutionarily conserved receptors that interact with the secreted Slit proteins. ROBO-Slit interactions play an important role in axon guidance across the midline during central nervous system development. ROBO signaling also has a role in tumor angiogenesis and immune responses. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice