132662-APC

RNF148 (Ring Finger Protein 148, MGC35222) (APC)

Size

£927.00

SKU:: 132662-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa139-239 from human RNF148 (NP_932351) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: RNF148 contains one PA (protease associated) domain and one RING-type zinc finger. The exact function of RNF148 remains unknown. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.