RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43)

Size

£685.00

SKU:: 132640
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-84 from human RNF12 (NP_057204) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.