Ring Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING)

Size

£685.00

SKU:: 132589
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa102-200 (NP_055586) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.