RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033)

Size

£685.00

SKU:: 132569
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human RHOXF1, aa1-184 (NP_644811.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RHOXF1 may be a transcription factor involved in reproductive processes. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.