132565-BIOTIN

RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (Biotin)

Size

£914.00

SKU:: 132565-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa106-205 from RHOQ (NP_036381) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: TC10 is a member of the Rho family of GTP-binding proteins and is closely related to Cdc42 and Rac 1. Cycling between inactive and active GTP-bound state, active TC10 can directly interact with Cdc42 kinase, p21-activated protein kinases as well as other kinases. Constitutive expression of active TC10 mutants (TC10/Q75L) in fibroblast decrease actin stress fiber and formation of plasma membrane microspikes, while wild type TC10 has no effect on fibroblast cell morphology. Mostly expressed in adipose and muscle tissues, TC10 has been found to be activated by C3G (from the insulin pathway) in adipocytes. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLI* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice