132537-HRP
RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (HRP)
Size
£914.00
- SKU:
- 132537-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to human RGS4, aa1-206 (AAH51869) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- RGS signaling proteins are highly diverse and multifunctional proteins acting as inhibitors of G-protein signaling. They function as GTPase activating proteins (GAPs) for G-alpha sub-units of heterotrimeric G proteins and drive G proteins into their inactive GDP-bound forms. RGS4 is a member of B/R4 sub-family of these proteins and consists of a highly conserved RGS domain. It plays a crucial role in regulating G-protein signaling, IP3-mediated Ca2+ signaling and relaxation of G-protein gated potassium channels. Located both in the cytosol and membrane-bound, it acts as a multifunctional scaffold protein and blocks G i/o-mediated signaling in mammalian cells. RGS4 selectively binds to PIP3 and blocks Gq/11-directed inositol lipid/Ca2+ signaling. It is regulated by post-translational modifications which include palmitoylation and phosphorylation of RGS domain. Role of RGS4 has been implicated in Schizophrenia and chronic heart failure. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice