132537-BIOTIN
RGS4 (Regulator of G-Protein Signaling 4, Regulator of G-Protein Signalling 4, RGS-4, MGC2124, MGC60244, RGP4, SCZD9) (Biotin)
Size
£914.00
- SKU:
- 132537-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to human RGS4, aa1-206 (AAH51869) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- RGS signaling proteins are highly diverse and multifunctional proteins acting as inhibitors of G-protein signaling. They function as GTPase activating proteins (GAPs) for G-alpha sub-units of heterotrimeric G proteins and drive G proteins into their inactive GDP-bound forms. RGS4 is a member of B/R4 sub-family of these proteins and consists of a highly conserved RGS domain. It plays a crucial role in regulating G-protein signaling, IP3-mediated Ca2+ signaling and relaxation of G-protein gated potassium channels. Located both in the cytosol and membrane-bound, it acts as a multifunctional scaffold protein and blocks G i/o-mediated signaling in mammalian cells. RGS4 selectively binds to PIP3 and blocks Gq/11-directed inositol lipid/Ca2+ signaling. It is regulated by post-translational modifications which include palmitoylation and phosphorylation of RGS domain. Role of RGS4 has been implicated in Schizophrenia and chronic heart failure. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice