132532-APC

RGS20 (Regulator of G-protein Signaling 20, Gz-selective GTPase-activating Protein, G(z)GAP, Gz-GAP, Regulator of G-protein Signaling Z1, Regulator of Gz-selective Protein Signaling 1, RGSZ1, ZGAP1) (APC)

Size

£927.00

SKU:: 132532-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa78-177 from RGS20 (NP_003693) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E10
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: RGS proteins are regulatory and structural components GPCR complexes. These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways. RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP. It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain. RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure. It specifically interacts and accelerates the hydrolysis of G-alphaz. Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling. It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice