RGS20 (Regulator of G-protein Signaling 20, Gz-selective GTPase-activating Protein, G(z)GAP, Gz-GAP, Regulator of G-protein Signaling Z1, Regulator of Gz-selective Protein Signaling 1, RGSZ1, ZGAP1) (FITC)

Size

£934.00

SKU:: 132531-FITC
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human RGS20, aa1-241 (NP_003693.2).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: RGS proteins are regulatory and structural components GPCR complexes. These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways. RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP. It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain. RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure. It specifically interacts and accelerates the hydrolysis of G-alphaz. Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling. It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice