132498-APC
RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) (APC)
Size
£927.00
- SKU:
- 132498-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa82-191, from human RFNG, from with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 6C7
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- The Drosophila melanogaster 'fringe' gene is a secreted signaling protein that is involved in the formation of boundaries between groups of cells during development. It acts by modulating the activation of te Notch signal transduction pathway. A human radical fringe homolog was identified in 1997. There is evidence to show that radical fringe homolog may be involve in limb formation and in neurogenesis in humans. It is a glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. It is a single-pass type II membrane protein which localises to the golgi apparatus membrane. It belongs to the glycosyltransferase 31 family. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice