RFFL (RING Finger and FYVE-like Domain-containing Protein 1, E3 Ubiquitin-protein Ligase Rififylin, Caspase Regulator CARP2, Caspases-8 and -10-associated RING Finger Protein 2, CARP2, CARP-2, FYVE-RING Finger Protein Sakura, Fring, RING Finger Protein 189, RNF189, RING Finger Protein 34-like, RNF34L)

Size

£685.00

SKU:: 132497
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-100 from human RFFL (NP_001017368) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQRE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.