132463-HRP
Regenerating Islet-derived Protein 3-alpha (REG-3-alpha, REG3A, REG3, Regenerating Islet-derived Protein III-alpha, Reg III-alpha, REG-III, FLJ18565, HIP, Human Proislet Peptide, Pancreatitis-associated Protein 1, PAP1, PAP, PAP-H, PBCGF) (HRP)
Size
£934.00
- SKU:
- 132463-HRP
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human REG3A, aa1-175 (NP_002571.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- REG3A, also known as Regenerating islet-derived protein 3 alpha, Reg III-alpha, and pancreatitis associated protein, is a 174aa containing stress protein involved in the control of bacterial proliferation. This secreted protein is generally found in the apical region of pancreatic acinar cells and appears in pancreatic juice after induction of pancreatic inflammation. It has a possible role in inducing new pancreatic islets development. REG3A belongs to the Reg-related family with a C-type lectin domain and is constitutively expressed in intestine while low expression is found in healthy pancreas. Overexpression of REG3A is seen during the acute phase of pancreatitis and in some patients with chronic pancreatitis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice