RECQL (ATP-dependent DNA Helicase Q1, DNA Helicase, RecQ-like Type 1, RecQ1, DNA-dependent ATPase Q1, RecQ Protein-like 1, RECQ1, RECQL1)

Size

£685.00

SKU:: 132458
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa549-649, from human RECQL (NP_116559) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.