132455-HRP
Recoverin (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (HRP)
Size
£914.00
- SKU:
- 132455-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa101-200, from human RCV1 (NP_002894) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4C6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- Recoverin belongs to a high-affinity calcium-binding family that includes neuronal calcium sensor-1, visinin-like proteins (VILIPs), guanylate cyclase-activating proteins (GCAPs), and Kv-channel interacting proteins (KchIPs). Features common to this family include four calcium-binding EF-hand domains, and an N-terminal myristoylation sequence. This family of proteins has been implicated in a broad range of cellular signaling functions, including phototransduction and neurotransmitter release, lipid metabolism, gene expression, and ion channel regulation. Myristoylation, the post-translational addition of a fatty acid tail, has been shown to have functional significance for other calcium-binding protein family members. Recoverin is subject to the posttranslational modification of myristoylation. Binding of calcium to recoverin elicits a change in conformation that exposes the buried hydrophobic myristoyl moiety to interaction with cell membranes and other cellular proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice