RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1)

Size

£685.00

SKU:: 132431
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa312-421 from human RCC1 (AAH07300) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RCC1 promotes the exchange of Ran-bound GDP by GTP. It is involved in the regulation of onset of chromosome condensation in the S phase. RCC1 binds to chromatin. The RCC1/Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Patients with Raynaud disease produce antibodies that bind to RCC1. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.