132431-BIOTIN
RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (Biotin)
Size
£914.00
- SKU:
- 132431-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa312-421 from human RCC1 (AAH07300) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- RCC1 promotes the exchange of Ran-bound GDP by GTP. It is involved in the regulation of onset of chromosome condensation in the S phase. RCC1 binds to chromatin. The RCC1/Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Patients with Raynaud disease produce antibodies that bind to RCC1. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice