RBM8A (RNA-binding Protein 8A, Binder of OVCA1-1, BOV-1, RNA-binding Motif Protein 8A, RNA-binding Protein Y14, Ribonucleoprotein RBM8A, RBM8, HSPC114, MDS014)

Size

£685.00

SKU:: 132402
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-174 from RBM8A (AAH17088) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RBM8A is a member of the EJC (The exon junction complex) that is involved in mRNA export, cytoplasmic localization and nonsense mediated mRNA decay. This protein has the ability to communicate to the cytoplasm the processing history of the mRNA, including the position of the removed introns. Although it shuttles to the cytoplasm, it is predominantly detected in the nucleus and is colocalized with oskar mRNA at the posterior pole of the cell. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice