132402-ML490

RBM8A (RNA-binding Protein 8A, Binder of OVCA1-1, BOV-1, RNA-binding Motif Protein 8A, RNA-binding Protein Y14, Ribonucleoprotein RBM8A, RBM8, HSPC114, MDS014) (MaxLight 490)

Size

£914.00

SKU:: 132402-ML490
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-174 from RBM8A (AAH17088) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Extra Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. RBM8A is a member of the EJC (The exon junction complex) that is involved in mRNA export, cytoplasmic localization and nonsense mediated mRNA decay. This protein has the ability to communicate to the cytoplasm the processing history of the mRNA, including the position of the removed introns. Although it shuttles to the cytoplasm, it is predominantly detected in the nucleus and is colocalized with oskar mRNA at the posterior pole of the cell. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice