132401-FITC

RBM6 (RNA-binding Protein 6, Lung Cancer Antigen NY-LU-12, Protein G16, RNA-binding Motif Protein 6, RNA-binding Protein DEF-3, DEF3) (FITC)

Size

£914.00

SKU:: 132401-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1024-1123 from RBM6 (NP_005768) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: RBM6 contains one G-patch domain and one RRM (RNA recognition motif) domain. It specifically binds poly(G) RNA homopolymers in vitro and is ubiquitously expressed in adults. Defects in RBM6 are found in non-small cell lung cancer (NSCLC) cell lines. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice