RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2)

Size

£685.00

SKU:: 132363
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa40-138 from RASSF8 (NP_009142) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Widely expressed as a 6.2kb transcript. A 2.2kb alternatively spliced transcript is expressed exclusively in testis. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunohistochemistry and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.