RAPGEF2 (Rap Guanine Nucleotide Exchange Factor 2, Neural RAP Guanine Nucleotide Exchange Protein, nRap GEP, PDZ Domain-containing Guanine Nucleotide Exchange Factor 1, PDZ-GEF1, RA-GEF, KIAA0313, NRAPGEP, PDZGEF1)

Size

£685.00

SKU:: 132307
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1398-1487 from RAPGEF2 (XP_376350) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Guanine nucleotide exchange factor (GEF) for Rap1A, Rap1B and Rap2B GTPases. Does not interact with cAMP or cGMP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.