RAMP3 (Receptor Activity-modifying Protein 3, Calcitonin-receptor-like Receptor Activity-modifying Protein 3, CRLR Activity-modifying Protein 3)

Size

£685.00

SKU:: 132296
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa24-148 of human RAMP3 (AAH22304; BC022304) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: RAMP3 (receptor calcitonin activity modifying protein 3) transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. It acts as a receptor for adrenomedullin (AM) together with CALCRL. It is strongly expressed in lung, breast, immune system and fetal tissues and belongs to the RAMP family. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.