RAMP1 (Receptor Activity Modifying Protein1, Receptor Activity Modifying Protein 1 [Precursor], Receptor (G-Protein-coupled) Activity Modifying Protein 1, Calcitonin Receptor-like Receptor Activity Modifying Protein 1, CRLR Activity Modifying Protein 1)

Size

£685.00

SKU:: 132294
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa27-117 from RAMP1 (NP_005846) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RAMPS may be involved in the transport of CRLR to the plasma membrane. RAMP1 (human, mouse, rat 148aa) presents the CRLR receptor as a glycoprotein that function as CGRP receptor. RAMP1 is expressed in many tissues, including the uterus, bladder, brain, pancreas, and GI tract. CRLR and RAMP1 are not co-expressed in all tissues suggesting that their co-expression may define which cells express functional CGRP receptors. RAMP2 (human 175aa; rat 182aa, and mouse 189aa)-transported receptors are core-glycosylated and function as ADM receptor. It is expressed in the lung, breast, immune system and fetal tissues. RAMP3 is most abundant in the kidney and lung. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice