132294-BIOTIN
RAMP1 (Receptor Activity Modifying Protein1, Receptor Activity Modifying Protein 1 [Precursor], Receptor (G-Protein-coupled) Activity Modifying Protein 1, Calcitonin Receptor-like Receptor Activity Modifying Protein 1, CRLR Activity Modifying Protein 1) (Biotin)
Size
£914.00
- SKU:
- 132294-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa27-117 from RAMP1 (NP_005846) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- RAMPS may be involved in the transport of CRLR to the plasma membrane. RAMP1 (human, mouse, rat 148aa) presents the CRLR receptor as a glycoprotein that function as CGRP receptor. RAMP1 is expressed in many tissues, including the uterus, bladder, brain, pancreas, and GI tract. CRLR and RAMP1 are not co-expressed in all tissues suggesting that their co-expression may define which cells express functional CGRP receptors. RAMP2 (human 175aa; rat 182aa, and mouse 189aa)-transported receptors are core-glycosylated and function as ADM receptor. It is expressed in the lung, breast, immune system and fetal tissues. RAMP3 is most abundant in the kidney and lung. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice