RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2, RalA Exchange Factor RalGPS2, Ral GEF with PH Domain and SH3-binding Motif 2, FLJ10244, FLJ25604)

Size

£685.00

SKU:: 132292
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa282-387 form human RALGPS2 (NP_689876) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Guanine nucleotide exchange factor for the small GTPase RALA. May be involved in cytoskeletal organization. May also be involved in the stimulation of transcription in a Ras-independent fashion. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.