RALB (Ras-related Protein Ral-B)

Size

£685.00

SKU:: 132283
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa89-183, from human RALB (AAH18163) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The human RAL proteins share more than 50% similarity and some properties with the ras proteins. One member of this family, RALA, maps to 7p. A second member of the family, RALB, encoding a GTP-binding protein is located on 2cen-q13. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.