RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303)

Size

£685.00

SKU:: 132272
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa36-146 from human RAET1E (NP_631904) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.