RAD51C (DNA Repair Protein RAD51 Homolog 3, R51H3, RAD51 Homolog C, RAD51-like Protein 2, MGC104277, RAD51L2)

Size

£685.00

SKU:: 132265
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to human RAD51C, aa1-135 (AAH00667) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F3-5C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The Rad51 DNA repair protein is a key component of the double-strand break repair pathway and is essential for mitotic and meiotic recombination and genome stability. Five human RAD51 homologs have been identified: XRCC2, XRCC3, RAD51B, RAD51C, and RAD51D. Each of these homologs interacts with one or more of the others, with all of the proteins involved in one complex or multiple smaller complexes. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.