RABEP1 (Rab GTPase-binding Effector Protein 1, Rabaptin-4, Rabaptin-5, Rabaptin-5alpha, Renal Carcinoma Antigen NY-REN-17, RAB5EP, RABPT5, RABPT5A)

Size

£685.00

SKU:: 132230
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa765-863 from RABEP1 (NP_004694) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Rab effector protein acting as linker between gamma-adaptin, RAB4A and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.