RAB4A (Ras-related Protein Rab-4A, RAB4)

Size

£685.00

SKU:: 132213
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human RAB4A, aa1-218 (NP_004569.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: RAB4A belongs to the small GTPase superfamily. RAB4A has been shown to interact with STX4, RAB11FIP1, RABEP1, CD2AP and KIF3B. Rab4 is also involved in the translocation of glucose transporter (Glu4) in adipocytes in response to insulin. Overexpression of Rab4 causes a redistribution of receptors on plasma membrane versus endocytic compartments. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.