RAB40B (Ras-related Protein Rab-40B, Protein Rar, SOCS Box-containing Protein RAR, RAR, SEC4L)

Size

£698.00

SKU:: 132208
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa179-278 from human RAB40B (AAH18039) with GST tag.
Clone:: 1A1
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.