RAB38 (Ras-related Protein Rab-38, Melanoma Antigen NY-MEL-1)

Size

£685.00

SKU:: 132198
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa115-212 from RAB38 (NP_071732) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.