RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11)

Size

£685.00

SKU:: 132160
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa554-652 from human RAB11FIP5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.