PXDN (Peroxidasin Homolog, Melanoma-associated Antigen MG50, Vascular Peroxidase 1, p53-responsive Gene 2 Protein, KIAA0230, MG50, PRG2, VPO, VPO1)

Size

£685.00

SKU:: 132118
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant peptide corresponding to aa1452-1562 of human PXDN (XP_056455) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Displays low peroxidase activity and is likely to participate in H2O2 metabolism and peroxidative reactions in the cardiovascular system. Plays a role in extracellular matrix formation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.