132096

PTX3 (Pentraxin-related Protein PTX3, Pentaxin-related Protein PTX3, Tumor Necrosis Factor alpha-induced Protein 5, TNF alpha-induced Protein 5, Tumor Necrosis Factor-inducible Gene 14 Protein, TSG-14, TNFAIP5, TSG14)

Size

£685.00

SKU:: 132096
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa282-380 from human PTX3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.