132093
PTTG1 (EAP1, PTTG, TUTR1, Securin, Esp1-associated Protein, Pituitary Tumor-transforming Gene 1 Protein)
Size
£685.00
- SKU:
- 132093
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-101 from PTTG1 (NP_004210) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2C3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- PTTG1 is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The protein has transforming activity in vitro and tumorigenic activity in vivo, and is highly expressed in various tumors. This protein contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the protein can act as a transactivation domain. It is mainly a cytosolic protein, although it partially localizes in the nucleus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice