132088

PTRF (Polymerase I and Transcript Release Factor, CAVIN1, Cavin-1, CAVIN, CGL4, FKSG13)

Size

£685.00

SKU:: 132088
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa233-321 from human PTRF with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 3ug/ml detects PTRF using immunoperoxidase staining on formalin fixed, paraffin embedded human pancreas. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.