132050

PTP4A2 (Protein-tyrosine Phosphatase 4a2, Protein Tyrosine Phosphatase Type IVA 2, BM-008, HU-PP-1, OV-1, PTPCAAX2, PTP(CAAXII), Protein-tyrosine Phosphatase of Regenerating Liver 2, PRL2, PRL-2)

Size

£685.00

SKU:: 132050
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-96 from PTP4A2 (NP_003470) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.