132048

PTN (Pleiotrophin, Heparin-binding Growth-associated Molecule, HB-GAM, Heparin-binding Growth Factor 8, HBGF-8, Osteoblast-specific Factor 1, OSF-1, Heparin-binding Neurite Outgrowth-promoting Factor 1, HBNF-1, Heparin-binding Brain Mitogen, HBBM, HBNF1, NEGF1)

Size

£685.00

SKU:: 132048
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa45-155, from human PTN (NP_002816) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Pleiotrophin or Neurite Growth-promoting Factor 1 (NEGF1), also called Heparin Affin Regulatory Peptide (HARP) or Heparin Binding Growth associated molecule (HB-GAM) is an 18-kDa growth factor that has a high affinity for heparin. It is structurally related to midkine and retinoic acid induced heparin-binding protein. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.