132048-ML490
PTN (Pleiotrophin, Heparin-binding Growth-associated Molecule, HB-GAM, Heparin-binding Growth Factor 8, HBGF-8, Osteoblast-specific Factor 1, OSF-1, Heparin-binding Neurite Outgrowth-promoting Factor 1, HBNF-1, Heparin-binding Brain Mitogen, HBBM, HBNF1, NEGF1) (MaxLight 490)
Size
£914.00
- SKU:
- 132048-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa45-155, from human PTN (NP_002816) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Pleiotrophin or Neurite Growth-promoting Factor 1 (NEGF1), also called Heparin Affin Regulatory Peptide (HARP) or Heparin Binding Growth associated molecule (HB-GAM) is an 18-kDa growth factor that has a high affinity for heparin. It is structurally related to midkine and retinoic acid induced heparin-binding protein. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice