132048-HRP

PTN (Pleiotrophin, Heparin-binding Growth-associated Molecule, HB-GAM, Heparin-binding Growth Factor 8, HBGF-8, Osteoblast-specific Factor 1, OSF-1, Heparin-binding Neurite Outgrowth-promoting Factor 1, HBNF-1, Heparin-binding Brain Mitogen, HBBM, HBNF1, NEGF1) (HRP)

Size

£914.00

SKU:: 132048-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa45-155, from human PTN (NP_002816) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Pleiotrophin or Neurite Growth-promoting Factor 1 (NEGF1), also called Heparin Affin Regulatory Peptide (HARP) or Heparin Binding Growth associated molecule (HB-GAM) is an 18-kDa growth factor that has a high affinity for heparin. It is structurally related to midkine and retinoic acid induced heparin-binding protein. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice