132048-BIOTIN
PTN (Pleiotrophin, Heparin-binding Growth-associated Molecule, HB-GAM, Heparin-binding Growth Factor 8, HBGF-8, Osteoblast-specific Factor 1, OSF-1, Heparin-binding Neurite Outgrowth-promoting Factor 1, HBNF-1, Heparin-binding Brain Mitogen, HBBM, HBNF1, NEGF1) (Biotin)
Size
£914.00
- SKU:
- 132048-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa45-155, from human PTN (NP_002816) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Pleiotrophin or Neurite Growth-promoting Factor 1 (NEGF1), also called Heparin Affin Regulatory Peptide (HARP) or Heparin Binding Growth associated molecule (HB-GAM) is an 18-kDa growth factor that has a high affinity for heparin. It is structurally related to midkine and retinoic acid induced heparin-binding protein. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice