132042-FITC

PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK) (FITC)

Size

£914.00

SKU:: 132042-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa682-871 from human PTK2B (AAH36651) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage-gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity. It's been shown to be involved in osmotic stress-dependent SNCA 'Tyr-125' phosphorylation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice