PTGES (Prostaglandin E Synthase, Microsomal Glutathione S-transferase 1-like 1, MGST1-L1, p53-induced Gene 12 Protein,PIG12, PGES, MGST1L1) (Not for Export EU)

Size

£760.00

SKU:: 132022
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human PTGES, aa1-152 (NP_004869.1).
Format:: Supplied as a liquid.
Extra Details:: PTGES is a glutathione-dependent prostaglandin E synthase. The expression of it has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that it may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. Applications: Suitable for use in Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.