132011-PE

PTEN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and Dual-specificity Protein Phosphatase PTEN, Mutated in Multiple Advanced Cancers 1, Phosphatase and Tensin Homolog, MMAC1, TEP1, MGC11227) (PE)

Size

£914.00

SKU:: 132011-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa221-320, from human PTEN (AAH05821) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The tumor suppressor phosphatase PTEN regulates cell migration, growth, and survival by dephosphorylating phosphatidylinositol second messengers and signaling phosphoproteins. PTEN protein is composed of an N-terminal dual specificity phosphatase-like enzyme domain and C-terminal noncatalytic regulatory domain that contains multiple putative phosphorylation sites, which could play an important role in the control of its biological activity. Proper phosphorylation of PTEN by CK2 is important for PTEN protein stability to proteasome-mediated degradation. The phosphorylation sites in PTEN are located within a C- terminal cluster of Ser/Thr residues. The CK2 phosphorylation sites were identified as PTEN residues Ser-370, Ser-380, Thr-382, Thr-383, and Ser-385. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice