131994

PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of Multicatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta)

Size

£685.00

SKU:: 131994
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91, from human PSME2 (NP_002809) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.