Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase)

Size

£685.00

SKU:: 131867
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa310-418 from human ACPP (AAH07460) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Respiratory syncytial virus (RSV) is the most significant respiratory pathogen of early development and causes about half of all cases of bronchiolitis and a quarter of all cases of pneumonia during the first few months of life. There are multiple types and subtypes of RSV. VP-R151 is a mixture of four antibodies to optimize sensitivity and detection of the various RSV forms. It does not cross- react with tissue culture isolates of influenza virus types A and B, parainfluenza virus types 1, 2, 3 and 4b, adeno- virus, herpes simplex virus types 1 and 2, varicella-zoster virus, cytomegalovirus, mumps virus, measles virus, ECHOvirus 19, coxsackie B4 virus, poliovirus types 1, 2 and 3 or negative tissue culture cells used in routine virus isolation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice